Email Verifier

We have verified over 90 million emails for over 100,000 users in the last year.
We can clean your email list too.

email

Type in an email address to verify it

Verifying
Valid
Unverifiable
Invalid

Registered users get 100 verifications for free!

Sign up to get additional data about the prospect, including their name, company, and job position.

We can’t verify this email, but we’ve got additional data for this prospect. Sign up to access the data.

No luck with email guessing? Sign up to find pre-verified prospects for your business.

Sign up and verify 100 emails for free

No luck with email guessing? Sign up to find pre-verified prospects for your business.

No luck with email guessing? Sign up to find pre-verified prospects for your business.

or

Upload your list for bulk verification

Good outreach is only possible if you reach the lead’s inbox.

Check every email address you have and reduce your bounce rate.

  • Individual email checker

    Verify email addresses on-the-go individually through an extension or app.

  • Bulk email verifier

    Our bulk email verifier tool will help you improve email campaign sending results with a complete email list verification. Simply upload your list to verify and clean emails and receive a ready-to-use valid email address list.

  • API

    Snov.io’s email address verifier API can build directly into your platform for integrated email validation at registration or lead form sign-up.

When you use Snov.io to verify an email address, it goes through our thorough 7-tier verification process:

  • 01

    Email format check

    We check that the email is typed correctly and all symbols are in place.

  • 02

    Gibberish check

    We assess the email’s validity analyzing whether it looks like gibberish.

  • 03

    Domain existence check

    Our algorithm checks whether the email’s domain is real.

  • 04

    Catch-all email and domain check

    The email and its domain are searched through known catch-all email and domain databases.

  • 05

    Freemail check

    We check whether an email is based on a freemail domain.

  • 06

    MX record check

    An MX record check lets us confirm the email is in use and able to accept mail.

  • 07

    SMTP authentication

    Also known as an email address ping, it's the most reliable way to check if an email is valid.

Frequently asked questions

  • What is the purpose of an Email Verifier?

    Email address verifier, or email checker, is a tool that can clean your email list from old or invalid emails. Sending to unverified email lists will lead to a high bounce rate and blocking of your email by ESPs. The goals of our service is to maintain the high reputation of your email account by improving the delivery rate of your campaigns.

  • How accurate are the email verification results?

    There is no way to verify an email with 100% accuracy without sending an actual email to it. That said, according to our latest tests, the bounce rate for emails that have received a “valid” status after email verification with Snov.io is only 1.72%. With our email checker, you can maintain an average deliverability of up to 98%.

  • Is the Email Verifier free?

    Snov.io Email Verifier is free to use on a free account. Free Snov.io accounts receive 50 credits/month for free. You can use the free plan for as long as you need, no credit card required upfront.

  • How much does 1 verification cost?

    1 email verification costs 0.5 credit/email found with Snov.io (you will only be charged if the email is valid) and 0.5 credit/email for uploaded emails (you are only charged for emails with valid or invalid status).

  • Can you verify any email?

    We will verify most email addresses, including custom domain emails. We do not verify emails from catch-all domains.

  • Can I verify email addresses in bulk?

    Yes, you can! Our bulk email verifier is available in the app or as an API.
    Bulk email address verification can be performed right in the email verifier tool: simply upload your list or find emails with our Email Finder tool and start email list verification.
Start using for free
Client reviews
toyotaquoraebayfiverrbuzzfeedduracellwalmartkiwinikemerckdisneyphilipstargetubisofthilton
Start using Snov.io for free

No credit card required upfront

Questions? We have answers - contact us at help@snov.io

footer-people.png