email finder

Email Finder

Find any email. Anywhere.

Your perfect lead is a click away. Let's find them.

We have found over 500,000,000 leads for over 680,000 users in the last 12 months

Start searching for free
  • email finder

    Find emails by domain

    Find all email addresses on any domain in a matter of minutes. Bulk domain option is handy if you want to explore up to 20,000 domains at a time.

  • email finder

    Find emails by company

    Use our database to find just the companies you need by industry, company size, location, name and more.

  • email finder

    Get emails from names

    Know your lead’s name and company domain but not their email? We can find it for you. Use this feature to complete your prospects lists with quality contacts.

  • email finder

    Collect emails with Boolean Search

    Search multiple lead sources for the perfect candidates and prospects. Browse by location, position, and skills with Boolean Search and filters.

Sign up for free to get 50 searches every month!
rocket

Who uses Snov.io?

Frequently asked questions

How can I find email addresses with Snov.io Email Finder?

When you register and install our extension, you get access to over half a dozen email finder features.

With Email Finder web app you can:

  • Upload a list of domains and receive a list of emails using Bulk Domain Search
  • Filter companies by name, industry, size and more, and find company email addresses with Company Profile Search
  • Upload a file with links to professional social network profiles and receive emails with Social URL Search
  • Upload a file with first name, last name and domain or url to find email addresses in bulk through Bulk Email Search feature
  • Collect emails in bulk from multiple platforms searching prospects by job title, skills, and location with Linker

You can also search for emails on the go with Snov.io Email Finder Chrome extension. Install the plugin and get leads' email addresses from company websites and search results pages.

How are you different from other email finder tools?

Snov.io gives you search results with the highest accuracy at the most affordable price. Over one million users already enjoy an all-in-one CRM, as it fulfills all sales needs.

Compare Snov.io Email Finder with other popular email finders on the web and choose what suits you best.

Can I find prospects on LinkedIn?

Yes, you can find pre-verified email addresses with the help of Social URL Search or install LI Prospect Finder Chrome extension to collect prospects directly from LinkedIn profiles and search pages.

How accurate are the collected email results?

The latest tests showed over 98% email accuracy with the bounce rate for valid emails of 1.72%, and 3.75% emails that received uncertain or valid status.

Emails you collect from LI are pre-verified. You can use Snov.io’s built-in Email Verifier to check emails collected from other sources.

Will I only find the name and the email of the prospect?

Depending on the source you’re collecting emails from, you will either find basic information (name and email address) or a full prospect’s profile. Currently, you can find and collect the following data:

  1. First name
  2. Last name
  3. Full name
  4. Prospect’s social profile
  5. Job position
  6. Locality
  7. Company name
  8. Company URL
  9. Company’s social profile
  10. Company size
  11. Company’s locality
  12. Country
  13. State
  14. City
  15. Industry

How much does it cost?

You get 50 free monthly credits upon registration. If you would like to purchase more credits to find emails or prospects, you can find our pricing page here. Plans start at only $39/month.

You can pay monthly or receive a 2-months-discount when you buy an annual plan.

Do you sell email lists?

We do not sell (or buy) databases. Use our email address finder tools to build your own highly-targeted, clean email lists and consistently fill your funnel with fresh leads.

Here's what our clients have to say
toyotaquoraebaybuzzfeedduracellwalmartkiwinikemerckdisneyphilipstargetubisofthilton