email finder

Email Finder

Find any email. Anywhere.

Your perfect lead is a click away. Let's find them.

We have found over 260 million emails for over 680,000 users in the last 12 months

Start using for free
  • email finder

    Find emails by domain

    Find all email addresses on any domain in a matter of minutes. Bulk domain option is handy if you want to explore up to 20,000 domains at a time.

  • email finder

    Find emails by company

    Use our database to find just the companies you need by industry, company size, location, name and more.

  • email finder

    Get emails from names

    Know your lead’s name and company domain but not their email? We can find it for you. Use this feature to complete your prospects lists with quality contacts.

  • email finder

    Collect emails with Boolean Search

    Search multiple lead sources for the perfect candidates and prospects. Browse by location, position, and skills with Boolean Search and filters.

Sign up for free to get 50 searches every month!
rocket

Who uses Snov.io?

Frequently asked questions

  • How can I find email addresses with Snov.io Email Finder?

    If you're wondering how to find someone's email address online, Snov.io is exactly what you need. When you register and install our extension, you get access to over half a dozen email finder features.

    With Email Finder web app you can:

    • Upload a list of domains and receive a list of emails using Bulk Domain Search
    • Filter companies by name, industry, size and more, and find company email addresses with Company Profile Search
    • Upload a file with links to professional social network profiles and receive emails with Social URL Search
    • Upload a file with first name, last name and domain or url to find email addresses in bulk through Bulk Email Search feature
    • Collect emails in bulk from multiple platforms searching prospects by job title, skills, and location with Linker

    You can also search for emails on the go with Snov.io Email Finder Chrome extension:

    • Open the extension on any webpage and find all emails on that domain
    • Collect emails through the search engine results page
    • Get an email address directly from the prospect’s professional social profile page or through the social network search page
  • How are you different from other email finder tools?

    Snov.io gives you the most at the most affordable price to make sure your business can bloom. We aim to be an all-in-one email outreach platform that will accommodate all your needs, which is why we never stop developing new useful features.

    Need email addresses to boost your business? Look up business emails online with Snov.io. If you want detailed information on why we are better than any other email finder, visit our competitors comparison page here.
  • Will I only find the name and the email of the prospect?

    Depending on the source you’re collecting emails from, you will either find basic information (name and email address) or a full prospect’s profile. Currently, you can find and collect the following data:

    1. First name
    2. Last name
    3. Full name
    4. Prospect’s social profile
    5. Job position
    6. Locality
    7. Company name
    8. Company URL
    9. Company’s social profile
    10. Company size
    11. Company’s locality
    12. Country
    13. State
    14. City
    15. Industry
  • How much does it cost?

    You get 50 free monthly credits upon registration. If you would like to purchase more credits to find emails or prospects, you can find our pricing page here. Plans start at only $39/months.

    You can pay monthly or receive a 2-months-discount when you buy an annual plan.
  • Do you sell email lists?

    We do not sell (or buy) databases. If you are looking for a tailor-made list of B2B sales leads collected specifically according to your ideal customer profile, Snov.io offers a Prospecting Service.

    You can also use our email address finder tools to build your own highly-targeted, clean email lists and consistently fill your funnel with fresh leads.
Start using now
Client reviews
toyotaquoraebayfiverrbuzzfeedduracellwalmartkiwinikemerckdisneyphilipstargetubisofthilton
Start using Snov.io for free

No credit card required upfront

Questions? We have answers - contact us at help@snov.io

footer-people.png